Gentaur Worldwide

Search results for: human elisa

Search filter:
Catalog Number Product Name Quantity Price [ € ]
CK-E11296 人高香草酸(HVA) ELISA Kit 96T 430
CSB-E09905Rb Ⅰ,IL-1sR Ⅰ ELISA kit 96T 634
CSB-E09905Rb Ⅰ,IL-1sR Ⅰ ELISA kit 96T 753
E-0414 δ-Endorphin (human) β-Lipotropin (59-85) (human), β-Endorphin (1-27) (human), Lipotropin C' Fragment (human) 98% C139H217N33O40S CAS: 76622-84-9 5mg 416
ACLPRO395B γ-Synuclein, Human, recombinant 100 µg. Ask for price
ACLPRO395 γ-Synuclein, Human, recombinant 20 µg. Ask for price
E-0412 γ-Endorphin β-Endorphin (1-17), β-Lipotropin (59-75) (human) 98% C83H131N19O27S CAS: 60893-02-9 5mg 299
825-96T βHCG ELISA KIT 96T FERTILITY ELISA KITS ELISA KIT Ask for price
825-96T βHCG ELISA KIT 192T FERTILITY ELISA KITS ELISA KIT Ask for price
TA639 β2-Microglobulin Elisa Kit, 96 Tests, Cancer Markers Elisa Kits Ask for price
KAPDTGPM02 β2-Glycoprotein I IgM ELISA ELISA KIT 96 Tests Ask for price
KAPDTGPM02 β2-Glycoprotein I IgM ELISA ELISA 96 Tests 225
KAPDTGPG02 β2-Glycoprotein I IgG ELISA ELISA KIT 96 Tests Ask for price
KAPDTGPG02 β2-Glycoprotein I IgG ELISA ELISA 96 Tests 225
ACLPRO388B β2 Glycoprotein-I, Human, recombinant 20 µg. Ask for price
ACLPRO388 β2 Glycoprotein-I, Human, recombinant 5 µg. Ask for price
ACLPRO394B β-Synuclein, Human, recombinant 100 µg. Ask for price
ACLPRO394 β-Synuclein, Human, recombinant 20 µg. Ask for price
LF-P0312 β-synuclein, Human type: Protein 0.2 mg 328
E-EL-0035 β-Nph (Beta-Naphthol) ELISA Kit kit 536
N-0203 β-Neoendorphin Prodynorphin (175-183) (human, porcine) 98% C54H77N13O12 CAS: 5mg 205
M-1417 β-MSH (monkey) β-MSH (5-22) (human) 98% C98H138N28O29S CAS: 17750-75-3 5mg 311
M-1414 β-MSH (human) 98% C118H174N34O35S CAS: 17908-57-5 5mg 357
RP10648 β-Melanocyte Stimulating Hormone (MSH), human  1,0mg  182
SP-62356-5 β-Interleukin I (163-171), human [Val-Gln-Gly-Glu-Glu-Ser-Asn-Asp-Lys (MW: 1005.01)] 5 mg 239
A1026 β-Interleukin I (163-171), human 25mg 232
A1026 β-Interleukin I (163-171), human 10mg Ask for price
A1026 β-Interleukin I (163-171), human 5mg Ask for price
RP11344 β-Endorphin, human  1,0mg  165
4060-v β-Endorphin (Human) 0.5mg 349
E-0404 β-Endorphin (human) β-Lipotropin (59-89) (human), Lipotropin C Fragment (human) 98% C158H251N39O46S CAS: 61214-51-5 5mg 467
SP-87424-1 β-Endorphin (6-31), human [Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu (MW: 2909.40)] 1 mg 239
E-0407 β-Endorphin (6-31) (human) β-Lipotropin (64-89) (human) 98% C131H218N34O40 CAS: 5mg 404
SP-89898-5 β-Endorphin (30-31) (human) [Gly-Glu (MW: 204.18)] 5 mg 174
E-0411 β-Endorphin (30-31) (human) β-Lipotropin (88-89) (human) 98% C7H12N2O5 CAS: 5mg 170
SP-89897-5 β-Endorphin (27-31) (human) [Tyr-Lys-Lys-Gly-Glu (MW: 623.71)] 5 mg 174
E-0409 β-Endorphin (27-31) (human) β-Lipotropin (85-89) (human) 98% C28H45N7O9 CAS: 77875-70-8 5mg 170
SP-89896-5 β-Endorphin (18-31) (human) [Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu (MW: 1623.93)] 5 mg 304
E-0408 β-Endorphin (18-31) (human) β-Lipotropin (76-89) (human) 98% C75H122N20O20 CAS: 74216-35-6 5mg 264
SP-87425-1 β-Endorphin (1-5), (16-31), human [Tyr-Gly-Gly-Phe-Met-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu (MW: 2393.86)] 1 mg 174
SP-87426-1 β-Endorphin (1-27), human [Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr (MW: 3022.54)] 1 mg 239
SP-87428-1 β-Endorphin (1-26), human [Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala (MW: 2859.36)] 1 mg 239
SP-88392-1 β-Defensin-4, human [Glu-Leu-Asp-Arg-Ile-Cys-Gly-Tyr-Gly-Thr-Ala-Arg-Cys-Arg-Lys-Lys-Cys-Arg-Ser-Gln-Glu-Tyr-Arg-Ile-Gly-Arg-Cys-Pro-Asn-Thr-Tyr-Ala-Cys-Cys-Leu-Arg-Lys (Disulfide 1 mg 304
4406-s β-Defensin-4 (Human) 0.1mg 387
SP-100511-1 β-Defensin-3, human (GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: Cys11-Cys40, Cys18-Cys33, Cys23-Cys41) (MW: 5155.22) 1 mg Ask for price
4382-s β-Defensin-3 (Human) 0.1mg 406
14338-v β-Defensin-2 (Human) Antiserum 50μl 472
4338-s β-Defensin-2 (Human) 0.1mg 396
4337-s β-Defensin-1 (Human) (hBD-1) 0.1mg 387
YIAE1042.2 β-Defensin 6, aa 1-38, Rabbit anti-Human; ELISA 100 ul. 1503
YIAE1042.1 β-Defensin 6, aa 1-38, Rabbit anti-Human; ELISA 20 ul. 401
YIAE1040.2 β-Defensin 5, aa 17-51, Rabbit anti-Human; ELISA 100 ul. 1503
YIAE1040.1 β-Defensin 5, aa 17-51, Rabbit anti-Human; ELISA 20 ul. 401
YIAE1046AG.2 β-Defensin 4, aa 3-39, Human synthetic peptide 1 mg. 4431
YIAE1046AG.1 β-Defensin 4, aa 3-39, Human synthetic peptide 100 μg. 549
YIAE1046.2 β-Defensin 4, aa 3-39, Clone: L13-10-D1, Mab anti-Human; paraffin, ELISA/RIA/IHC/WB 100 µg. 1801
YIAE1046.1 β-Defensin 4, aa 3-39, Clone: L13-10-D1, Mab anti-Human; paraffin, ELISA/RIA/IHC/WB 10 µg. 441
YIAE1050AG.2 β-Defensin 3, aa 6-22, Human synthetic peptide 1 mg. 1840
YIAE1050AG.1 β-Defensin 3, aa 6-22, Human synthetic peptide 100 μg. 268
YIAE1050.2 β-Defensin 3, aa 6-22, Clone: L3-18b-E1, Mab anti-Human; RIA/ELISA 100 µl. 1801
YIAE1050.1 β-Defensin 3, aa 6-22, Clone: L3-18b-E1, Mab anti-Human; RIA/ELISA 20 µl. 441
YIAE1110AG.2 β-Defensin 2, aa 4-41, Human synthetic peptide 1 mg. 2836
YIAE1110AG.1 β-Defensin 2, aa 4-41, Human synthetic peptide 100 μg. 437
YIAE1110.2 β-Defensin 2, aa 4-41, Clone: L12-4C-C2, Mab anti-Human; ELISA 100 µg. 1801
YIAE1110.1 β-Defensin 2, aa 4-41, Clone: L12-4C-C2, Mab anti-Human; ELISA 10 µg. 441
YIAE1048.2 β-Defensin 1, aa 28-34, Rabbit anti-Human 100 µl. 1503
YIAE1048.1 β-Defensin 1, aa 28-34, Rabbit anti-Human 20 µl. 401
YIAE1048AG.2 β-Defensin 1, aa 28-34, Human synthetic peptide 1 mg. 1381
YIAE1048AG.1 β-Defensin 1, aa 28-34, Human synthetic peptide 100 μg. Ask for price
YIAE1049.2 β-Defensin 1, aa 18-26, Rabbit anti-Human 100 µl. 1503
YIAE1049.1 β-Defensin 1, aa 18-26, Rabbit anti-Human 20 µl. 401
YIAE1049AG.2 β-Defensin 1, aa 18-26, Human synthetic peptide 1 mg. 1381
YIAE1049AG.1 β-Defensin 1, aa 18-26, Human synthetic peptide 100 μg. Ask for price
YIAE1047.2 β-Defensin 1, aa 1-5, Rabbit anti-Human; ELISA 100 µl. 1503
YIAE1047.1 β-Defensin 1, aa 1-5, Rabbit anti-Human; ELISA 20 µl. 401
YIAE1047AG.2 β-Defensin 1, aa 1-5, Human synthetic peptide 1 mg. 1381
YIAE1047AG.1 β-Defensin 1, aa 1-5, Human synthetic peptide 100 μg. Ask for price
YIAE1109AG.2 β-Defensin 1, aa 1-36, Human synthetic peptide 1 mg. 2836
YIAE1109AG.1 β-Defensin 1, aa 1-36, Human synthetic peptide 100 μg. 437
YIAE1109.2 β-Defensin 1, aa 1-36, Clone: M11-14b-D10, Mab anti-Human; ELISA/WB 100 µg. 1801
YIAE1109.1 β-Defensin 1, aa 1-36, Clone: M11-14b-D10, Mab anti-Human; ELISA/WB 10 µg. 441
UBT1301 β-conglycinin ELISA Kit 96T 742
UBT1301 β-conglycinin ELISA Kit 96T 742
UBT1301 β-conglycinin ELISA Kit 96T 787
UBT1301 β-conglycinin ELISA Kit 96T 787
C-0511 β-CGRP (human) CGRP-II (human) 98% C162H267N51O48S3 CAS: 101462-82-2 5mg 698
K3383-100 β-catenin (rat) ELISA Kit 100 assays 533
K3382-100 β-catenin (mouse) ELISA Kit 100 assays 533
K3381-100 β-catenin (human) ELISA Kit 100 assays 533
RP11056-25 β-Casomorphin, human  25,0mg  186
RP11056-5 β-Casomorphin, human  5 x 5,0mg  211
C-0901-2 β-Casomorphin (human) 98% C44H61N7O11 CAS: 102029-74-3 5mg 182
BMAT4168 β-Atrial Natriuretic Peptide (ANP) [1-28], dimer, antiparallel, Rabbit anti-Human; RIA vial 1570
BMAT4170 β-Atrial Natriuretic Peptide (ANP) [1-28], dimer, antiparallel, Rabbit anti-Human; IH 50 µl. 811
BMAS3163 β-Atrial Natriuretic Peptide (ANP) [1-28], dimer, antiparallel, Rabbit anti-Human, IF Kit kit 1026
BMAS1189 β-Atrial Natriuretic Peptide (ANP) [1-28], dimer, antiparallel, Rabbit anti-Human, EIA Kit kit 1463
BMAT4169 β-Atrial Natriuretic Peptide (ANP) [1-28], dimer, antiparallel, Rabbit anti-Human 400 µg. 1463
4168-s β-ANP (Human) 0.1mg 453
LF-P0051 β-Amyloid 42, Human type: Protein 0.5 mg 308
RP20527-1 β-Amyloid (1-42), human  1,0mg  295

PreNext

Search Tips