Contact Us

GENTAUR Europe

 GENTAUR Europe BVBA
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45 
Fax 0032 16 50 90 45
This email address is being protected from spambots. You need JavaScript enabled to view it.  

Gentaur Bulgaria

 GENTAUR BULGARIA
53 Iskar Str. 1191 Kokalyane, Sofia
Tel 0035924682280 
Fax 0035929830072
This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR France

     GENTAUR France SARL
    9, rue Lagrange, 75005 Paris 
    Tel 01 43 25 01 50 
    Fax 01 43 25 01 60
    This email address is being protected from spambots. You need JavaScript enabled to view it.
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    Gentaur Germany

      GmbH Marienbongard 20
    52062 Aachen Deutschland
    Tel (+49) 0241 56 00 99 68 
    Fax (+49) 0241 56 00 47 88 
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    This email address is being protected from spambots. You need JavaScript enabled to view it.

     

    Gentaur London

     GENTAUR Ltd. 
    Howard Frank Turnberry House 
    1404-1410 High Road 
    Whetstone London N20 9BH 
    Tel 020 3393 8531 
    Fax 020 8445 9411
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Poland

     GENTAUR Poland Sp. z o.o. 

    ul. Grunwaldzka 88/A m.2

    81-771 Sopot, Poland
    Tel  058 710 33 44
    Fax 058 710 33 48 
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Nederland

     GENTAUR Nederland BV
    Kuiper 1 
    5521 DG Eersel Nederland
    Tel 0208-080893 
    Fax 0497-517897
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    Gentaur Italy

     GENTAUR SRL IVA IT03841300167

    Piazza Giacomo Matteotti, 6, 24122 Bergamo
    Tel 02 36 00 65 93 
    Fax 02 36 00 65 94
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Spain

     GENTAUR Spain
    Tel 0911876558
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    Genprice USA
    Gentaur Serbia

    serbiaSerbia, Macedonia FlagMacedonia, 

    montenegro-flagMontenegro, croatiaCroatia: 
    Tel 0035929830070 
    Fax 0035929830072
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Romania

    romGENTAUR Romania

    Tel 0035929830070 
    Fax 0035929830072
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Greece

    grGENTAUR Greece 

    Tel 00302111768494 
    Fax 0032 16 50 90 45

    This email address is being protected from spambots. You need JavaScript enabled to view it.

    Other countries

    Other countries
    Luxembourg +35220880274
    Schweiz Züri +41435006251
    Danmark +4569918806
    Österreich +43720880899
    Ceská republika Praha +420246019719
    Ireland Dublin +35316526556
    Norge Oslo +4721031366
    Finland Helsset +358942419041
    Sverige Stockholm +46852503438
    Magyarország Budapest +3619980547

    seal-in-search-symantec

     

     

    Monday, 25 November 2013 16:25

    Uracil DNA-Glycosilase (UDGase)

    Protein UNG PDB 1akz

    Cat. num.: BIO-27044

    Quantity: 500 Units

    Description
    Uracil DNA Glycosylase (UDG) catalyzes the release of uracil from uracil-containing single or double-stranded DNA, but not from RNA or oligonucleotides (6 or fewer bases). UDG is active over a broad pH range with an optimum at pH 8.0, does not require a divalent cation, and is inhibited by high ionic strength (>200mM). 
    UDG is purified to SDS-PAGE purity and is free of endonucleases, exonucleases, nickases and RNases. 

    Source: Recombinant E. coli strain carrying the over-expressed modified gene of Uracil DNA Glycosylase from E. coli.

    Features
    • Removal of uracil from uracil-containing DNA
    • Novel temperature sensitive mutant irreversibly inactive after
    heating

    Applications
    • UDG treatment of uracil-containing DNA to prevent
    amplification by DNA Polymerases
    • Used to investigate features of protein-DNA interactions

    Storage and stability:
    Uracil DNA Glycosylase (UDG) is shipped on Dry/Blue Ice. It should be stored at -20°C upon receipt. When stored under optimum conditions, the reagents are stable for 24 months from date of purchase.

    Storage and Dilution Buffer:
    20mM Tris-Cl, pH 8.0, 0.1M NaCl, 0.1mM EDTA, 1mM DTT, 0.1% stabilizer and 50% glycerol.

    Price: 57 €

    Order Button1

    Published in Top Products
    Wednesday, 20 November 2013 16:14

    Recombinant proteins

    Recombinant Human IL-4 produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids and having a molecular mass of 15000 Dalton. The rHuIL-4 is purified by proprietary chromatographic techniques.

    Recombinant human mGMP-1

    Recombinant human interleukin-2 is a sterile protein product for injection. rHuIL-2 is produced by recombinant DNA technology using Yeast. It is a highly purified protein containing 133 amino acids, with cysteine mutated to alanine at 125 amino acid position, and has a molecular weight of approximately 15.4kD, non-glycosylated.

    Recombinant human mGMP-2

     

    Recombinant human GM-CSF produced in E.coli is a single, non-glycosylated, polypeptide chain containing 127 amino acids, two pairs of disulfide bonds and having a molecular mass of approximately 14.5kD.

    Pricelist:

    Cat. Product Quantity Promo Price Order
    04-GMPhuIL4-50 µg Recombinant Human Interleukin-4 50 µg 482 € Order
    04-RHIL2-08F02 Recombinant Human Interleukin-2    195 € Order
    04-RHUGM-CSF-50 µg Recombinant human mGMP
    GM-CSF 
    50 µg 195 € Order
    04-RHUGM-CSF-7A10 Recombinant human Pre-GMP GM-CSF  
    Molgramostim-Leukoma
    300 µg 385 € Order
    Published in Top Products
    Friday, 16 August 2013 10:22

    WESTERN BLOTS

    western blot gentaur molecular products antibodiesWestern blotting allows visualization of antibodies directed against specific viral proteins.
    - Available for SIV, HTLV I/II, HIV and Helicobacter pylori
    - Easy to use, complete kits containing everything needed for antibody detection
    - Nitrocellulose strips available for use with your own detection system*
    *for SIV and HTLV I/II

    SIV BLOT
    SIV STRIPS

    Simian Immunodeficiency Virus (SIV) is the most closely related lentivirus to Human Immunodeficiency (HIV), therefore, SIV infection in monkeys has become the best animal model for studying the pathogenesis and efficacy of vaccines against HIV infection in humans. The SIV Western Blot assay is a qualitative enzyme immunoassay for the in vitro detection of antibodies to SIV in serum or plasma. 

     

    HTLV BLOT 2.4* 
    HTLV I/II STRIPS

    The MP Biomedicals ® HTLV BLOT 2.4 is a qualitative enzyme immunoassay for detecting antibodies to HTLV-I and HTLV-II in human serum or plasma. The HTLV blot 2.4 incorporates MTA-1, a unique HTLV-1 envelope recombinant protein (rgp46-I), K55, a unique HTLV-II envelope recombinant protein (rgp46-II) and GD21, a common yet specific HTLV-I and HTLV-II epitope recombinant protein on the blot. This test is supplied for research purposes only. 

    Check out our product list

    HELICO BLOT 2.1*

    The MP Biomedicals ® HELICO BLOT 2.1 Western blot kit is a qualitative assay for the detection of IgG antibodies to Helicobacter pylori (H. pylori) in human serum or plasma. In addition to bacterial lysate there is a recombinant antigen with high predictive value for the indication of current H. pylori infection. The assay is intended for use as a serological test for the detection of both current and past infection with H. pylori. Unlike an ELISA, the HELICO BLOT 2.1 allows for the detection of antibodies to specific proteins of H. pylori, including antigens associated with pathology such as CagA and VacA. This kit is supplied for research purposes only. 

    Click here for more information

    HIV-1 BLOT 1.3 * 

    The MP Biomedicals ® HIV-1 BLOT 1.3 is a qualitative enzyme immunoassay for the detection of antibodies to HIV-1 in human serum or plasma. The assay supplied for research use only and is not intended for use in diagnosis and prognosis of disease. 

     

    Published in Promos
    Friday, 12 July 2013 14:15

    Recombinant Protein

    Product Name:

    Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

    Product Type: Recombinant Protein
    Application: Immunogen,ELISA
    Code: CSB-YP321587AXQ   >>   Yeast
    CSB-EP321587AXQ   >>   E.coli
    CSB-BP321587AXQ   >>   Baculovirus
    CSB-MP321587AXQ   >>   Mammalian cell
    Size: 1mg
    Protein Names: Recommended name:
    37 kDa salivary gland allergen Aed a 2
    Alternative name(s):
    Protein D7
    Allergen= Aed a 2
    Gene Names: Name:D7
    ORF Names:AAEL006424
    Species:

    Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

    Product Info: His tagged
    Purity: >90%
    Storage Buffer: PBS pH 7.4, 50% glycerol
    Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
    Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
    AA sequence:
    STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
    DASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKA HKDTSKNLFHGNKELTKG
    LYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYT VLDDALFKEHTDCVMKGIRYITKNNEL
    DAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSN AGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYA
    FNLPKKQVYSKPAVQSQVMEIDGK QCPQ
     
    STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
    DASVIQEQFKAYPSLGEKSKVEAYA...... 
    Expression Region: 18-321

     

    Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

    CSB-YP321587AXQ >> Yeast € 2090/ mg
    CSB-EP321587AXQ >> E.coli € 1680/ mg
    CSB-BP321587AXQ >> Baculovirus € 2540/200ug
    CSB-MP321587AXQ >> Mammalian cell € 2980/200ug
    Expression Region :18-321aa;full length.

    Order Button1

    Published in Promos