Print this page
Friday, 12 July 2013 14:15

Recombinant Protein

Rate this item
(1 Vote)
Product Name:

Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Product Type: Recombinant Protein
Application: Immunogen,ELISA
Code: CSB-YP321587AXQ   >>   Yeast
CSB-EP321587AXQ   >>   E.coli
CSB-BP321587AXQ   >>   Baculovirus
CSB-MP321587AXQ   >>   Mammalian cell
Size: 1mg
Protein Names: Recommended name:
37 kDa salivary gland allergen Aed a 2
Alternative name(s):
Protein D7
Allergen= Aed a 2
Gene Names: Name:D7
ORF Names:AAEL006424
Species:

Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Product Info: His tagged
Purity: >90%
Storage Buffer: PBS pH 7.4, 50% glycerol
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA sequence:
STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
DASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKA HKDTSKNLFHGNKELTKG
LYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYT VLDDALFKEHTDCVMKGIRYITKNNEL
DAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSN AGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYA
FNLPKKQVYSKPAVQSQVMEIDGK QCPQ
 
STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
DASVIQEQFKAYPSLGEKSKVEAYA...... 
Expression Region: 18-321

 

Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

CSB-YP321587AXQ >> Yeast € 2090/ mg
CSB-EP321587AXQ >> E.coli € 1680/ mg
CSB-BP321587AXQ >> Baculovirus € 2540/200ug
CSB-MP321587AXQ >> Mammalian cell € 2980/200ug
Expression Region :18-321aa;full length.

Order Button1

Read 1626 times

Related items